Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3934471..3935068 | Replicon | chromosome |
Accession | NZ_CP100114 | ||
Organism | Klebsiella pneumoniae strain HSKP1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | NIL09_RS19200 | Protein ID | WP_004142563.1 |
Coordinates | 3934751..3935068 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | NIL09_RS19195 | Protein ID | WP_004142561.1 |
Coordinates | 3934471..3934758 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL09_RS19165 (3930551) | 3930551..3930799 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
NIL09_RS19170 (3930817) | 3930817..3931158 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
NIL09_RS19175 (3931189) | 3931189..3932304 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
NIL09_RS19180 (3932484) | 3932484..3933065 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
NIL09_RS19185 (3933065) | 3933065..3933433 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
NIL09_RS19190 (3933553) | 3933553..3934206 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NIL09_RS19195 (3934471) | 3934471..3934758 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NIL09_RS19200 (3934751) | 3934751..3935068 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL09_RS19205 (3935253) | 3935253..3936296 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
NIL09_RS19210 (3936966) | 3936966..3937832 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
NIL09_RS19215 (3937941) | 3937941..3939368 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T250213 WP_004142563.1 NZ_CP100114:c3935068-3934751 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |