Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 346078..346664 Replicon chromosome
Accession NZ_CP100114
Organism Klebsiella pneumoniae strain HSKP1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NIL09_RS01615 Protein ID WP_002920800.1
Coordinates 346296..346664 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NIL09_RS01610 Protein ID WP_004174006.1
Coordinates 346078..346299 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL09_RS01590 (342235) 342235..343161 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NIL09_RS01595 (343158) 343158..344435 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NIL09_RS01600 (344432) 344432..345199 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NIL09_RS01605 (345201) 345201..345914 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NIL09_RS01610 (346078) 346078..346299 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NIL09_RS01615 (346296) 346296..346664 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NIL09_RS01620 (346937) 346937..348253 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NIL09_RS01625 (348360) 348360..349247 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NIL09_RS01630 (349244) 349244..350089 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NIL09_RS01635 (350091) 350091..351161 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 343158..351898 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T250206 WP_002920800.1 NZ_CP100114:346296-346664 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT250206 WP_004174006.1 NZ_CP100114:346078-346299 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References