Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3985658..3986255 | Replicon | chromosome |
| Accession | NZ_CP100110 | ||
| Organism | Klebsiella pneumoniae strain HSKP104 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | NIL12_RS19490 | Protein ID | WP_004142563.1 |
| Coordinates | 3985938..3986255 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | NIL12_RS19485 | Protein ID | WP_004142561.1 |
| Coordinates | 3985658..3985945 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL12_RS19455 (3981738) | 3981738..3981986 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
| NIL12_RS19460 (3982004) | 3982004..3982345 | - | 342 | WP_025403994.1 | RamA family antibiotic efflux transcriptional regulator | - |
| NIL12_RS19465 (3982376) | 3982376..3983491 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
| NIL12_RS19470 (3983671) | 3983671..3984252 | + | 582 | WP_215402451.1 | TetR/AcrR family transcriptional regulator | - |
| NIL12_RS19475 (3984252) | 3984252..3984620 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
| NIL12_RS19480 (3984740) | 3984740..3985393 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| NIL12_RS19485 (3985658) | 3985658..3985945 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NIL12_RS19490 (3985938) | 3985938..3986255 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIL12_RS19495 (3986440) | 3986440..3987483 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
| NIL12_RS19500 (3988153) | 3988153..3989019 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| NIL12_RS19505 (3989128) | 3989128..3990555 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T250195 WP_004142563.1 NZ_CP100110:c3986255-3985938 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |