Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 343654..344240 Replicon chromosome
Accession NZ_CP100110
Organism Klebsiella pneumoniae strain HSKP104

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NIL12_RS01600 Protein ID WP_002920800.1
Coordinates 343872..344240 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NIL12_RS01595 Protein ID WP_004174006.1
Coordinates 343654..343875 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL12_RS01575 (339811) 339811..340737 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NIL12_RS01580 (340734) 340734..342011 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NIL12_RS01585 (342008) 342008..342775 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NIL12_RS01590 (342777) 342777..343490 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NIL12_RS01595 (343654) 343654..343875 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NIL12_RS01600 (343872) 343872..344240 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NIL12_RS01605 (344513) 344513..345829 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NIL12_RS01610 (345936) 345936..346823 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NIL12_RS01615 (346820) 346820..347665 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NIL12_RS01620 (347667) 347667..348737 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 340734..349474 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T250187 WP_002920800.1 NZ_CP100110:343872-344240 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT250187 WP_004174006.1 NZ_CP100110:343654-343875 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References