Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3263799..3264385 Replicon chromosome
Accession NZ_CP100102
Organism Klebsiella pneumoniae strain HSKP33

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NIL14_RS15585 Protein ID WP_002920800.1
Coordinates 3264017..3264385 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NIL14_RS15580 Protein ID WP_004174006.1
Coordinates 3263799..3264020 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL14_RS15560 (3259956) 3259956..3260882 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NIL14_RS15565 (3260879) 3260879..3262156 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NIL14_RS15570 (3262153) 3262153..3262920 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NIL14_RS15575 (3262922) 3262922..3263635 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NIL14_RS15580 (3263799) 3263799..3264020 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NIL14_RS15585 (3264017) 3264017..3264385 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NIL14_RS15590 (3264658) 3264658..3265974 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NIL14_RS15595 (3266081) 3266081..3266968 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NIL14_RS15600 (3266965) 3266965..3267810 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NIL14_RS15605 (3267812) 3267812..3268882 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3260879..3269619 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T250156 WP_002920800.1 NZ_CP100102:3264017-3264385 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT250156 WP_004174006.1 NZ_CP100102:3263799-3264020 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References