Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3983748..3984345 | Replicon | chromosome |
Accession | NZ_CP100094 | ||
Organism | Klebsiella pneumoniae strain HSKP5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | NIL16_RS19485 | Protein ID | WP_004142563.1 |
Coordinates | 3984028..3984345 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | NIL16_RS19480 | Protein ID | WP_004142561.1 |
Coordinates | 3983748..3984035 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL16_RS19450 (3979828) | 3979828..3980076 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
NIL16_RS19455 (3980094) | 3980094..3980435 | - | 342 | WP_025403994.1 | RamA family antibiotic efflux transcriptional regulator | - |
NIL16_RS19460 (3980466) | 3980466..3981581 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
NIL16_RS19465 (3981761) | 3981761..3982342 | + | 582 | WP_215402451.1 | TetR/AcrR family transcriptional regulator | - |
NIL16_RS19470 (3982342) | 3982342..3982710 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
NIL16_RS19475 (3982830) | 3982830..3983483 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NIL16_RS19480 (3983748) | 3983748..3984035 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NIL16_RS19485 (3984028) | 3984028..3984345 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL16_RS19490 (3984530) | 3984530..3985573 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
NIL16_RS19495 (3986243) | 3986243..3987109 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
NIL16_RS19500 (3987218) | 3987218..3988645 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T250119 WP_004142563.1 NZ_CP100094:c3984345-3984028 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |