Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 4568414..4569011 | Replicon | chromosome |
| Accession | NZ_CP100087 | ||
| Organism | Klebsiella pneumoniae strain HSKP8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | NIL17_RS22215 | Protein ID | WP_004142563.1 |
| Coordinates | 4568694..4569011 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | NIL17_RS22210 | Protein ID | WP_004142561.1 |
| Coordinates | 4568414..4568701 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL17_RS22180 (4564494) | 4564494..4564742 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
| NIL17_RS22185 (4564760) | 4564760..4565101 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| NIL17_RS22190 (4565132) | 4565132..4566247 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
| NIL17_RS22195 (4566427) | 4566427..4567008 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
| NIL17_RS22200 (4567008) | 4567008..4567376 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
| NIL17_RS22205 (4567496) | 4567496..4568149 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| NIL17_RS22210 (4568414) | 4568414..4568701 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NIL17_RS22215 (4568694) | 4568694..4569011 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIL17_RS22220 (4569196) | 4569196..4570239 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
| NIL17_RS22225 (4570909) | 4570909..4571775 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| NIL17_RS22230 (4571884) | 4571884..4573311 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T250102 WP_004142563.1 NZ_CP100087:c4569011-4568694 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |