Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 9650..10324 Replicon plasmid pRJKP36-1
Accession NZ_CP100077
Organism Klebsiella pneumoniae strain RJKP36

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LMS5
Locus tag NIL00_RS25605 Protein ID WP_032720638.1
Coordinates 9650..9973 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NIL00_RS25610 Protein ID WP_032720637.1
Coordinates 10022..10324 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL00_RS25580 (4676) 4676..6075 - 1400 Protein_6 ISNCY-like element ISKpn21 family transposase -
NIL00_RS25585 (6187) 6187..7719 + 1533 WP_023288255.1 IS3-like element ISKpn38 family transposase -
NIL00_RS25590 (7991) 7991..8593 + 603 Protein_8 transposase -
NIL00_RS25595 (8662) 8662..9089 - 428 Protein_9 DNA-binding protein -
NIL00_RS25600 (9067) 9067..9472 + 406 Protein_10 DUF4113 domain-containing protein -
NIL00_RS25605 (9650) 9650..9973 + 324 WP_032720638.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIL00_RS25610 (10022) 10022..10324 + 303 WP_032720637.1 NadS family protein Antitoxin
NIL00_RS25615 (10367) 10367..10534 - 168 WP_153591440.1 hypothetical protein -
NIL00_RS25620 (10722) 10722..10928 - 207 WP_153591439.1 hypothetical protein -
NIL00_RS25625 (10925) 10925..11308 - 384 WP_032720636.1 hypothetical protein -
NIL00_RS25630 (11413) 11413..11985 - 573 WP_032720635.1 GNAT family N-acetyltransferase -
NIL00_RS25635 (11987) 11987..12799 - 813 WP_223203129.1 TSUP family transporter -
NIL00_RS25640 (12811) 12811..13731 - 921 WP_050548604.1 TauD/TfdA family dioxygenase -
NIL00_RS25645 (14034) 14034..14527 - 494 Protein_19 DNA-binding protein -
NIL00_RS25650 (14558) 14558..15128 - 571 Protein_20 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..134731 134731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(45-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(39-83)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12372.29 Da        Isoelectric Point: 9.6240

>T250068 WP_032720638.1 NZ_CP100077:9650-9973 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK

Download         Length: 324 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11211.12 Da        Isoelectric Point: 7.3611

>AT250068 WP_032720637.1 NZ_CP100077:10022-10324 [Klebsiella pneumoniae]
MEKKLFDALISSMEEMVAIENGQIQPAAEQVHRHTLPDVKAIRKHAGMKQAEFAEVVGASVDLVRSWEQQRRVPSGIALK
MLCLIEREPALINTLRGIHV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LMS5

Antitoxin

Source ID Structure

References