Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 269619..270205 | Replicon | chromosome |
| Accession | NZ_CP100076 | ||
| Organism | Klebsiella pneumoniae strain RJKP36 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | NIL00_RS01220 | Protein ID | WP_002920800.1 |
| Coordinates | 269837..270205 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | NIL00_RS01215 | Protein ID | WP_004174006.1 |
| Coordinates | 269619..269840 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL00_RS01195 (265776) | 265776..266702 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIL00_RS01200 (266699) | 266699..267976 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIL00_RS01205 (267973) | 267973..268740 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NIL00_RS01210 (268742) | 268742..269455 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NIL00_RS01215 (269619) | 269619..269840 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NIL00_RS01220 (269837) | 269837..270205 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NIL00_RS01225 (270478) | 270478..271794 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NIL00_RS01230 (271901) | 271901..272788 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NIL00_RS01235 (272785) | 272785..273630 | + | 846 | WP_004181473.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NIL00_RS01240 (273632) | 273632..274702 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 266699..275439 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T250055 WP_002920800.1 NZ_CP100076:269837-270205 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |