Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 98423..98676 | Replicon | plasmid pRJKP41-1 |
| Accession | NZ_CP100073 | ||
| Organism | Klebsiella pneumoniae strain RJKP41 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NIL01_RS26695 | Protein ID | WP_001312851.1 |
| Coordinates | 98423..98572 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 98617..98676 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL01_RS26660 (93782) | 93782..94197 | - | 416 | Protein_117 | IS1-like element IS1B family transposase | - |
| NIL01_RS26665 (94446) | 94446..94847 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NIL01_RS26670 (94780) | 94780..95037 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NIL01_RS26675 (95130) | 95130..95783 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NIL01_RS26680 (96722) | 96722..97579 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NIL01_RS26685 (97598) | 97598..97776 | - | 179 | Protein_122 | protein CopA/IncA | - |
| NIL01_RS26690 (97891) | 97891..98139 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NIL01_RS26695 (98423) | 98423..98572 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (98617) | 98617..98676 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (98617) | 98617..98676 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (98617) | 98617..98676 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (98617) | 98617..98676 | + | 60 | NuclAT_1 | - | Antitoxin |
| NIL01_RS26700 (98877) | 98877..99209 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| NIL01_RS26705 (99271) | 99271..99870 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NIL01_RS26710 (100256) | 100256..100456 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| NIL01_RS26715 (100588) | 100588..101148 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NIL01_RS26720 (101203) | 101203..101949 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NIL01_RS26725 (101969) | 101969..102169 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| NIL01_RS26730 (102194) | 102194..102898 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NIL01_RS26735 (102951) | 102951..103016 | + | 66 | Protein_132 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / catA2 | - | 1..164564 | 164564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T250050 WP_001312851.1 NZ_CP100073:c98572-98423 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT250050 NZ_CP100073:98617-98676 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
