Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3977895..3978492 | Replicon | chromosome |
Accession | NZ_CP100072 | ||
Organism | Klebsiella pneumoniae strain RJKP41 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | NIL01_RS19450 | Protein ID | WP_004142563.1 |
Coordinates | 3978175..3978492 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | NIL01_RS19445 | Protein ID | WP_004142561.1 |
Coordinates | 3977895..3978182 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL01_RS19415 (3973975) | 3973975..3974223 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
NIL01_RS19420 (3974241) | 3974241..3974582 | - | 342 | WP_025403994.1 | RamA family antibiotic efflux transcriptional regulator | - |
NIL01_RS19425 (3974613) | 3974613..3975728 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
NIL01_RS19430 (3975908) | 3975908..3976489 | + | 582 | WP_215402451.1 | TetR/AcrR family transcriptional regulator | - |
NIL01_RS19435 (3976489) | 3976489..3976857 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
NIL01_RS19440 (3976977) | 3976977..3977630 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NIL01_RS19445 (3977895) | 3977895..3978182 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NIL01_RS19450 (3978175) | 3978175..3978492 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL01_RS19455 (3978677) | 3978677..3979720 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
NIL01_RS19460 (3980390) | 3980390..3981256 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
NIL01_RS19465 (3981365) | 3981365..3982792 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T250039 WP_004142563.1 NZ_CP100072:c3978492-3978175 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |