Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 981278..981537 | Replicon | chromosome |
| Accession | NZ_CP099990 | ||
| Organism | Staphylococcus equorum strain PU1 | ||
Toxin (Protein)
| Gene name | SprG2 | Uniprot ID | - |
| Locus tag | NHN23_RS04675 | Protein ID | WP_002511402.1 |
| Coordinates | 981278..981385 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 981375..981537 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHN23_RS04645 | 976510..977382 | + | 873 | WP_002507156.1 | ABC transporter ATP-binding protein | - |
| NHN23_RS04650 | 977382..978110 | + | 729 | WP_002507157.1 | ABC transporter permease subunit | - |
| NHN23_RS04655 | 978193..978753 | - | 561 | WP_002507158.1 | thioredoxin family protein | - |
| NHN23_RS04660 | 978969..979409 | + | 441 | WP_231111012.1 | hypothetical protein | - |
| NHN23_RS04665 | 979504..980064 | + | 561 | WP_002511403.1 | DUF1700 domain-containing protein | - |
| NHN23_RS04670 | 980061..980912 | + | 852 | WP_253345685.1 | DUF4097 family beta strand repeat-containing protein | - |
| NHN23_RS04675 | 981278..981385 | + | 108 | WP_002511402.1 | putative holin-like toxin | Toxin |
| - | 981375..981537 | - | 163 | - | - | Antitoxin |
| NHN23_RS04680 | 981673..981843 | - | 171 | WP_021339983.1 | tyrosine-type recombinase/integrase | - |
| NHN23_RS04685 | 982151..983191 | - | 1041 | WP_021339984.1 | C45 family autoproteolytic acyltransferase/hydolase | - |
| NHN23_RS04690 | 983686..983856 | + | 171 | WP_002507168.1 | hypothetical protein | - |
| NHN23_RS04695 | 984250..984660 | - | 411 | WP_002507169.1 | YolD-like family protein | - |
| NHN23_RS04700 | 984837..985874 | + | 1038 | WP_021339833.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3756.72 Da Isoelectric Point: 10.4997
>T250029 WP_002511402.1 NZ_CP099990:981278-981385 [Staphylococcus equorum]
VVPIVEALHLMLGFGTFIVTLLGLVVAIVKLSHKK
VVPIVEALHLMLGFGTFIVTLLGLVVAIVKLSHKK
Download Length: 108 bp
Antitoxin
Download Length: 163 bp
>AT250029 NZ_CP099990:c981537-981375 [Staphylococcus equorum]
ATTTGATAATATTTTTATGTTGTGGTAATTTATATATAGAAAAAGGGCAACACACCATAAGTGTATCGCCCTAATGAGCC
CGTTAAAAAGACGGTGGCTGGAATTTAATAATGATTAAATAATCATCTCATCCTCGCCAAAGTTAGAGATGGTTATTTTT
TAT
ATTTGATAATATTTTTATGTTGTGGTAATTTATATATAGAAAAAGGGCAACACACCATAAGTGTATCGCCCTAATGAGCC
CGTTAAAAAGACGGTGGCTGGAATTTAATAATGATTAAATAATCATCTCATCCTCGCCAAAGTTAGAGATGGTTATTTTT
TAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|