Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2792504..2793158 | Replicon | chromosome |
Accession | NZ_CP099975 | ||
Organism | Halomonas sp. Y3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NHL60_RS13285 | Protein ID | WP_253444178.1 |
Coordinates | 2792504..2792845 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NHL60_RS13290 | Protein ID | WP_253444181.1 |
Coordinates | 2792856..2793158 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHL60_RS13255 | 2787604..2789082 | - | 1479 | WP_253444162.1 | glutamate--tRNA ligase | - |
NHL60_RS13260 | 2789231..2789971 | + | 741 | WP_253444165.1 | SDR family NAD(P)-dependent oxidoreductase | - |
NHL60_RS13265 | 2790094..2790684 | + | 591 | WP_253444167.1 | helix-turn-helix transcriptional regulator | - |
NHL60_RS13270 | 2790690..2791277 | - | 588 | WP_253444170.1 | hypothetical protein | - |
NHL60_RS13275 | 2791347..2791733 | - | 387 | WP_253444172.1 | TraR/DksA C4-type zinc finger protein | - |
NHL60_RS13280 | 2791828..2792067 | - | 240 | WP_253444175.1 | hypothetical protein | - |
NHL60_RS13285 | 2792504..2792845 | + | 342 | WP_253444178.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHL60_RS13290 | 2792856..2793158 | + | 303 | WP_253444181.1 | XRE family transcriptional regulator | Antitoxin |
NHL60_RS13295 | 2793155..2793382 | + | 228 | WP_253444184.1 | hypothetical protein | - |
NHL60_RS13300 | 2793474..2794484 | + | 1011 | WP_253444187.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
NHL60_RS13305 | 2794495..2795526 | - | 1032 | WP_253444190.1 | succinylglutamate desuccinylase/aspartoacylase family protein | - |
NHL60_RS13310 | 2795686..2796303 | + | 618 | WP_253444193.1 | TetR family transcriptional regulator | - |
NHL60_RS13315 | 2796333..2797088 | - | 756 | WP_253444196.1 | enoyl-CoA hydratase-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13194.96 Da Isoelectric Point: 6.4688
>T250021 WP_253444178.1 NZ_CP099975:2792504-2792845 [Halomonas sp. Y3]
MWQIEQTSTFEEWYFSLDDTDRENVLAALLMLRERGPMLPRPHADTVNGSQYRNMKELRIQSQGRPLRAFFAFDPRRTGI
VLCAGDKTGNKRFYDDLIPVADREYAAHLESLK
MWQIEQTSTFEEWYFSLDDTDRENVLAALLMLRERGPMLPRPHADTVNGSQYRNMKELRIQSQGRPLRAFFAFDPRRTGI
VLCAGDKTGNKRFYDDLIPVADREYAAHLESLK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|