Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4488652..4489254 | Replicon | chromosome |
Accession | NZ_CP099973 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain SE006 |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | NHL55_RS21805 | Protein ID | WP_001159635.1 |
Coordinates | 4488943..4489254 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NHL55_RS21800 | Protein ID | WP_000362050.1 |
Coordinates | 4488652..4488942 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHL55_RS21785 (4486145) | 4486145..4487047 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
NHL55_RS21790 (4487044) | 4487044..4487679 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NHL55_RS21795 (4487676) | 4487676..4488605 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
NHL55_RS21800 (4488652) | 4488652..4488942 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NHL55_RS21805 (4488943) | 4488943..4489254 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
NHL55_RS21810 (4489472) | 4489472..4490401 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
NHL55_RS21815 (4490487) | 4490487..4490798 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
NHL55_RS21820 (4490795) | 4490795..4491241 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NHL55_RS21825 (4491256) | 4491256..4492197 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NHL55_RS21830 (4492242) | 4492242..4492679 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
NHL55_RS21835 (4492676) | 4492676..4493548 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NHL55_RS21840 (4493542) | 4493542..4494141 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T250014 WP_001159635.1 NZ_CP099973:c4489254-4488943 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT250014 WP_000362050.1 NZ_CP099973:c4488942-4488652 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|