Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2443980..2444205 Replicon chromosome
Accession NZ_CP099973
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain SE006

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag NHL55_RS11895 Protein ID WP_000813254.1
Coordinates 2443980..2444135 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2444147..2444205 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHL55_RS11860 2439087..2439368 - 282 WP_000445513.1 phage holin family protein -
NHL55_RS11865 2439358..2439546 - 189 WP_001688615.1 putative holin -
NHL55_RS11870 2439540..2439863 - 324 Protein_2324 tellurite/colicin resistance protein -
NHL55_RS11875 2442034..2442570 - 537 WP_000640113.1 DUF1133 family protein -
NHL55_RS11880 2442567..2442857 - 291 WP_000774470.1 DUF1364 domain-containing protein -
NHL55_RS11885 2442857..2443456 - 600 WP_000940751.1 DUF1367 family protein -
NHL55_RS11890 2443519..2443689 - 171 WP_000734094.1 hypothetical protein -
NHL55_RS11895 2443980..2444135 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2444147..2444205 + 59 - - Antitoxin
NHL55_RS11900 2444562..2445494 + 933 WP_000556390.1 hypothetical protein -
NHL55_RS11905 2445491..2446045 + 555 WP_001033796.1 hypothetical protein -
NHL55_RS11910 2446207..2446536 - 330 WP_001676916.1 DUF977 family protein -
NHL55_RS11915 2446580..2446627 - 48 Protein_2333 hypothetical protein -
NHL55_RS11920 2446809..2447276 + 468 WP_001227859.1 helix-turn-helix domain-containing protein -
NHL55_RS11925 2447661..2447816 + 156 WP_085981757.1 DUF1391 family protein -
NHL55_RS11930 2447924..2448445 - 522 WP_000004762.1 super-infection exclusion protein B -
NHL55_RS11935 2448883..2449104 + 222 WP_000560208.1 cell division protein FtsZ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2438545..2450416 11871


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T250002 WP_000813254.1 NZ_CP099973:c2444135-2443980 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT250002 NZ_CP099973:2444147-2444205 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References