Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 607756..608555 | Replicon | chromosome |
| Accession | NZ_CP099914 | ||
| Organism | Escherichia albertii strain 104_2_TS_A | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
| Locus tag | NIY84_RS02995 | Protein ID | WP_059227548.1 |
| Coordinates | 607756..608220 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | NIY84_RS03000 | Protein ID | WP_001296435.1 |
| Coordinates | 608220..608555 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY84_RS02965 (602757) | 602757..603191 | - | 435 | WP_149451364.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NIY84_RS02970 (603209) | 603209..604087 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NIY84_RS02975 (604077) | 604077..604856 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NIY84_RS02980 (604867) | 604867..605340 | - | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NIY84_RS02985 (605363) | 605363..606643 | - | 1281 | WP_256878807.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NIY84_RS02990 (606892) | 606892..607701 | + | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
| NIY84_RS02995 (607756) | 607756..608220 | - | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NIY84_RS03000 (608220) | 608220..608555 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NIY84_RS03005 (608704) | 608704..610275 | - | 1572 | WP_256878808.1 | galactarate dehydratase | - |
| NIY84_RS03010 (610646) | 610646..611980 | + | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NIY84_RS03015 (611996) | 611996..612766 | + | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T249971 WP_059227548.1 NZ_CP099914:c608220-607756 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|