Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 252716..253416 | Replicon | chromosome |
| Accession | NZ_CP099914 | ||
| Organism | Escherichia albertii strain 104_2_TS_A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIY84_RS01135 | Protein ID | WP_256879206.1 |
| Coordinates | 253126..253416 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIY84_RS01130 | Protein ID | WP_000806446.1 |
| Coordinates | 252716..253054 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY84_RS01105 (247755) | 247755..249737 | + | 1983 | WP_059251954.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| NIY84_RS01110 (249786) | 249786..250814 | + | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| NIY84_RS01115 (250886) | 250886..251416 | - | 531 | WP_256879204.1 | LuxR C-terminal-related transcriptional regulator | - |
| NIY84_RS01120 (251563) | 251563..252129 | - | 567 | WP_059216822.1 | outer membrane lipoprotein Slp | - |
| NIY84_RS01125 (252476) | 252476..252625 | - | 150 | WP_233991781.1 | hypothetical protein | - |
| NIY84_RS01130 (252716) | 252716..253054 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| NIY84_RS01135 (253126) | 253126..253416 | - | 291 | WP_256879206.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIY84_RS01140 (253593) | 253593..254072 | + | 480 | WP_059215194.1 | hypothetical protein | - |
| NIY84_RS01145 (254162) | 254162..254335 | - | 174 | WP_000553433.1 | hypothetical protein | - |
| NIY84_RS01150 (254363) | 254363..254446 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| NIY84_RS01155 (254500) | 254500..255852 | - | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
| NIY84_RS01160 (255924) | 255924..256766 | - | 843 | WP_010326142.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11429.03 Da Isoelectric Point: 8.8483
>T249969 WP_256879206.1 NZ_CP099914:c253416-253126 [Escherichia albertii]
INIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNCYSSIRVNNQYRLIFK
WVNGKAEDLYLDPHKY
INIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNCYSSIRVNNQYRLIFK
WVNGKAEDLYLDPHKY
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|