Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2016861..2017232 | Replicon | chromosome |
Accession | NZ_CP099912 | ||
Organism | Escherichia albertii strain 105_1_LWG_A |
Toxin (Protein)
Gene name | ralR | Uniprot ID | A0A891STD1 |
Locus tag | NIY85_RS09795 | Protein ID | WP_042853000.1 |
Coordinates | 2017038..2017232 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2016861..2017039 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY85_RS09755 (2012301) | 2012301..2012957 | - | 657 | WP_025238866.1 | carbon-nitrogen hydrolase family protein YobB | - |
NIY85_RS09760 (2013059) | 2013059..2013289 | - | 231 | WP_000916758.1 | DNA polymerase III subunit theta | - |
NIY85_RS09765 (2013428) | 2013428..2013805 | + | 378 | WP_256876740.1 | CopC domain-containing protein YobA | - |
NIY85_RS09770 (2013809) | 2013809..2014681 | + | 873 | WP_025238867.1 | copper homeostasis membrane protein CopD | - |
NIY85_RS09775 (2014694) | 2014694..2015035 | + | 342 | WP_000976487.1 | DUF2511 domain-containing protein | - |
NIY85_RS09780 (2015427) | 2015427..2016503 | - | 1077 | WP_256876741.1 | phage integrase Arm DNA-binding domain-containing protein | - |
NIY85_RS09785 (2016469) | 2016469..2016750 | - | 282 | WP_001311878.1 | excisionase | - |
- (2016861) | 2016861..2017039 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2016861) | 2016861..2017039 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2016861) | 2016861..2017039 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2016861) | 2016861..2017039 | + | 179 | NuclAT_0 | - | Antitoxin |
NIY85_RS09790 (2016857) | 2016857..2017045 | - | 189 | WP_001356607.1 | DUF1187 family protein | - |
NIY85_RS09795 (2017038) | 2017038..2017232 | - | 195 | WP_042853000.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NIY85_RS09800 (2017289) | 2017289..2018098 | - | 810 | WP_000166317.1 | recombination protein RecT | - |
NIY85_RS09805 (2018091) | 2018091..2020745 | - | 2655 | WP_112022726.1 | exodeoxyribonuclease VIII | - |
NIY85_RS09810 (2020845) | 2020845..2021120 | - | 276 | WP_001452559.1 | hypothetical protein | - |
NIY85_RS09815 (2021195) | 2021195..2021365 | - | 171 | WP_001359121.1 | YdaE family protein | - |
NIY85_RS09820 (2021365) | 2021365..2021586 | - | 222 | WP_000560227.1 | cell division protein FtsZ | - |
NIY85_RS09825 (2021998) | 2021998..2022150 | - | 153 | WP_000379561.1 | DUF1391 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2015427..2028265 | 12838 | |
- | inside | Prophage | - | - | 1946108..2079226 | 133118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7019.87 Da Isoelectric Point: 8.6419
>T249952 WP_042853000.1 NZ_CP099912:c2017232-2017038 [Escherichia albertii]
MRYDDVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDDVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT249952 NZ_CP099912:2016861-2017039 [Escherichia albertii]
GAGGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCTTTTT
CAATAGTGGCAGTTATTTT
GAGGACAGAAGTTTCTCGCAATTAAAATTTATCAGCTTTACTTTCTGCTCTCTGGACACGCCTGCTTCTTTTTTCCCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAATTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCTTTTT
CAATAGTGGCAGTTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|