Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 189779..190491 | Replicon | chromosome |
| Accession | NZ_CP099912 | ||
| Organism | Escherichia albertii strain 105_1_LWG_A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | NIY85_RS00875 | Protein ID | WP_000162413.1 |
| Coordinates | 189779..190081 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIY85_RS00880 | Protein ID | WP_000806446.1 |
| Coordinates | 190153..190491 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY85_RS00850 (186442) | 186442..187284 | + | 843 | WP_025238143.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
| NIY85_RS00855 (187356) | 187356..188708 | + | 1353 | WP_256876822.1 | glutathione-disulfide reductase | - |
| NIY85_RS00860 (188762) | 188762..188845 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| NIY85_RS00865 (188873) | 188873..189046 | + | 174 | WP_000553433.1 | hypothetical protein | - |
| NIY85_RS00870 (189136) | 189136..189615 | - | 480 | WP_025238141.1 | hypothetical protein | - |
| NIY85_RS00875 (189779) | 189779..190081 | + | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIY85_RS00880 (190153) | 190153..190491 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| NIY85_RS00885 (190548) | 190548..190715 | + | 168 | WP_232529606.1 | hypothetical protein | - |
| NIY85_RS00890 (191077) | 191077..191643 | + | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| NIY85_RS00895 (191790) | 191790..192320 | + | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| NIY85_RS00900 (192392) | 192392..193420 | - | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| NIY85_RS00905 (193469) | 193469..195450 | - | 1982 | Protein_181 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T249944 WP_000162413.1 NZ_CP099912:189779-190081 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|