Detailed information of TA system TA249939

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 59779..60205
• Replicon: plasmid plas1
• Accession: NZ_CP099911
• Organism: Escherichia albertii strain 110_1_TBG_A

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIY87_RS23930
• Protein ID: WP_001372321.1
• Coordinates: 59779..59904 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	59981..60205 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIY87_RS23885 (54827)	54827..55054	-	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-
NIY87_RS23890 (55148)	55148..55834	-	687	WP_000332493.1	PAS domain-containing protein	-
NIY87_RS23895 (56025)	56025..56408	-	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIY87_RS23900 (56685)	56685..57332	+	648	WP_256876177.1	transglycosylase SLT domain-containing protein	-
NIY87_RS23905 (57629)	57629..58450	-	822	WP_001234469.1	DUF932 domain-containing protein	-
NIY87_RS23910 (58570)	58570..58857	-	288	WP_000107535.1	hypothetical protein	-
NIY87_RS23915 (58882)	58882..59088	-	207	WP_000547971.1	hypothetical protein	-
NIY87_RS23920 (59158)	59158..59331	+	174	Protein_61	hypothetical protein	-
NIY87_RS23925 (59329)	59329..59559	-	231	WP_256876178.1	hypothetical protein	-
NIY87_RS23930 (59779)	59779..59904	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIY87_RS23935 (59846)	59846..59995	-	150	Protein_64	plasmid maintenance protein Mok	-
- (59981)	59981..60205	-	225	NuclAT_0	-	Antitoxin
- (59981)	59981..60205	-	225	NuclAT_0	-	Antitoxin
- (59981)	59981..60205	-	225	NuclAT_0	-	Antitoxin
- (59981)	59981..60205	-	225	NuclAT_0	-	Antitoxin
NIY87_RS23940 (60017)	60017..60205	+	189	WP_001299721.1	hypothetical protein	-
NIY87_RS23945 (60174)	60174..60936	-	763	Protein_66	plasmid SOS inhibition protein A	-
NIY87_RS23950 (60933)	60933..61367	-	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
NIY87_RS23955 (61422)	61422..63380	-	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
NIY87_RS23960 (63445)	63445..63678	-	234	WP_000006030.1	DUF905 family protein	-
NIY87_RS23965 (63740)	63740..64279	-	540	WP_000290812.1	single-stranded DNA-binding protein	-
NIY87_RS23970 (64305)	64305..64511	-	207	WP_000547971.1	hypothetical protein	-
NIY87_RS23975 (64752)	64752..64979	-	228	WP_071594011.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	espL2	1..89096	89096

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T249939 WP_001372321.1 NZ_CP099911:c59904-59779 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT249939 NZ_CP099911:c60205-59981 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin