Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3714653..3715303 | Replicon | chromosome |
| Accession | NZ_CP099910 | ||
| Organism | Escherichia albertii strain 110_1_TBG_A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIY87_RS18205 | Protein ID | WP_059224977.1 |
| Coordinates | 3714962..3715303 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | NIY87_RS18200 | Protein ID | WP_025237546.1 |
| Coordinates | 3714653..3714952 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY87_RS18170 (3709783) | 3709783..3710094 | - | 312 | WP_059224980.1 | hypothetical protein | - |
| NIY87_RS18175 (3710099) | 3710099..3710491 | - | 393 | WP_000273381.1 | flagellar export chaperone FliS | - |
| NIY87_RS18180 (3710514) | 3710514..3711830 | - | 1317 | WP_000609691.1 | flagellar filament capping protein FliD | - |
| NIY87_RS18185 (3711897) | 3711897..3712232 | - | 336 | WP_256876143.1 | hypothetical protein | - |
| NIY87_RS18190 (3712343) | 3712343..3713257 | - | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| NIY87_RS18195 (3713744) | 3713744..3714595 | + | 852 | WP_233991701.1 | winged helix-turn-helix domain-containing protein | - |
| NIY87_RS18200 (3714653) | 3714653..3714952 | - | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| NIY87_RS18205 (3714962) | 3714962..3715303 | - | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIY87_RS18210 (3715379) | 3715379..3716356 | - | 978 | WP_059224976.1 | hypothetical protein | - |
| NIY87_RS18215 (3716373) | 3716373..3717302 | - | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
| NIY87_RS18220 (3717317) | 3717317..3718693 | - | 1377 | WP_233991702.1 | flagellar hook-associated protein FlgK | - |
| NIY87_RS18225 (3719251) | 3719251..3719550 | - | 300 | WP_059224974.1 | rod-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T249931 WP_059224977.1 NZ_CP099910:c3715303-3714962 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|