Detailed information of TA system TA249914

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 36628..36897
• Replicon: plasmid plas1
• Accession: NZ_CP099908
• Organism: Escherichia albertii strain 112_1_EW_A

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIY89_RS23880
• Protein ID: WP_001372321.1
• Coordinates: 36772..36897 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	36628..36693 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIY89_RS23835	31697..31924	+	228	WP_071594011.1	hypothetical protein	-
NIY89_RS23840	32165..32371	+	207	WP_000547971.1	hypothetical protein	-
NIY89_RS23845	32397..32936	+	540	WP_000290812.1	single-stranded DNA-binding protein	-
NIY89_RS23850	32998..33231	+	234	WP_000006030.1	DUF905 family protein	-
NIY89_RS23855	33296..35254	+	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
NIY89_RS23860	35309..35743	+	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
NIY89_RS23865	35740..36502	+	763	Protein_45	plasmid SOS inhibition protein A	-
NIY89_RS23870	36471..36659	-	189	WP_001299721.1	hypothetical protein	-
-	36471..36695	+	225	NuclAT_0	-	-
-	36471..36695	+	225	NuclAT_0	-	-
-	36471..36695	+	225	NuclAT_0	-	-
-	36471..36695	+	225	NuclAT_0	-	-
-	36628..36693	-	66	-	-	Antitoxin
NIY89_RS23875	36681..36830	+	150	Protein_47	plasmid maintenance protein Mok	-
NIY89_RS23880	36772..36897	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIY89_RS23885	37117..37347	+	231	WP_256876178.1	hypothetical protein	-
NIY89_RS23890	37345..37518	-	174	Protein_50	hypothetical protein	-
NIY89_RS23895	37588..37794	+	207	WP_000547971.1	hypothetical protein	-
NIY89_RS23900	37819..38106	+	288	WP_000107535.1	hypothetical protein	-
NIY89_RS23905	38226..39047	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NIY89_RS23910	39344..39991	-	648	WP_256876177.1	transglycosylase SLT domain-containing protein	-
NIY89_RS23915	40268..40651	+	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIY89_RS23920	40842..41528	+	687	WP_000332493.1	PAS domain-containing protein	-
NIY89_RS23925	41622..41849	+	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	espL2 / espL2	1..89078	89078

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T249914 WP_001372321.1 NZ_CP099908:36772-36897 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT249914 NZ_CP099908:c36693-36628 [Escherichia albertii]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin