Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3717225..3717875 | Replicon | chromosome |
| Accession | NZ_CP099907 | ||
| Organism | Escherichia albertii strain 112_1_EW_A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIY89_RS18235 | Protein ID | WP_059224977.1 |
| Coordinates | 3717534..3717875 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | NIY89_RS18230 | Protein ID | WP_025237546.1 |
| Coordinates | 3717225..3717524 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY89_RS18200 (3712355) | 3712355..3712666 | - | 312 | WP_059224980.1 | hypothetical protein | - |
| NIY89_RS18205 (3712671) | 3712671..3713063 | - | 393 | WP_000273381.1 | flagellar export chaperone FliS | - |
| NIY89_RS18210 (3713086) | 3713086..3714402 | - | 1317 | WP_000609691.1 | flagellar filament capping protein FliD | - |
| NIY89_RS18215 (3714469) | 3714469..3714804 | - | 336 | WP_256876143.1 | hypothetical protein | - |
| NIY89_RS18220 (3714915) | 3714915..3715829 | - | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| NIY89_RS18225 (3716316) | 3716316..3717167 | + | 852 | WP_233991701.1 | winged helix-turn-helix domain-containing protein | - |
| NIY89_RS18230 (3717225) | 3717225..3717524 | - | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| NIY89_RS18235 (3717534) | 3717534..3717875 | - | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIY89_RS18240 (3717951) | 3717951..3718928 | - | 978 | WP_059224976.1 | hypothetical protein | - |
| NIY89_RS18245 (3718945) | 3718945..3719874 | - | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
| NIY89_RS18250 (3719889) | 3719889..3721265 | - | 1377 | WP_233991702.1 | flagellar hook-associated protein FlgK | - |
| NIY89_RS18255 (3721823) | 3721823..3722122 | - | 300 | WP_059224974.1 | rod-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T249904 WP_059224977.1 NZ_CP099907:c3717875-3717534 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|