Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2864361..2864586 Replicon chromosome
Accession NZ_CP099907
Organism Escherichia albertii strain 112_1_EW_A

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag NIY89_RS14205 Protein ID WP_000813269.1
Coordinates 2864361..2864516 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2864528..2864586 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY89_RS14160 2859646..2860143 - 498 WP_001135262.1 lysozyme RrrD -
NIY89_RS14165 2860143..2860358 - 216 WP_000839574.1 class II holin family protein -
NIY89_RS14180 2861158..2861976 - 819 WP_256876231.1 CPBP family intramembrane metalloprotease -
NIY89_RS14185 2862119..2862487 - 369 WP_059217965.1 antiterminator Q family protein -
NIY89_RS14190 2862480..2862857 - 378 WP_059274539.1 RusA family crossover junction endodeoxyribonuclease -
NIY89_RS14195 2862858..2863913 - 1056 WP_105210958.1 DUF968 domain-containing protein -
NIY89_RS14200 2863915..2864193 - 279 WP_059274501.1 hypothetical protein -
NIY89_RS14205 2864361..2864516 - 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
- 2864528..2864586 + 59 - - Antitoxin
NIY89_RS14210 2864777..2864860 - 84 Protein_2780 ORF6N domain-containing protein -
NIY89_RS14215 2865122..2865895 + 774 WP_256876232.1 alpha/beta hydrolase -
NIY89_RS14220 2866251..2866661 - 411 WP_059274497.1 DUF977 family protein -
NIY89_RS14225 2866669..2867430 - 762 WP_059274498.1 DUF1627 domain-containing protein -
NIY89_RS14230 2867454..2868200 - 747 WP_059274499.1 ATP-binding protein -
NIY89_RS14235 2868207..2869169 - 963 WP_105210960.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - espM2 / espM2 / espW 2831316..2883431 52115


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T249901 WP_000813269.1 NZ_CP099907:c2864516-2864361 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT249901 NZ_CP099907:2864528-2864586 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References