Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1053849..1054095 | Replicon | chromosome |
| Accession | NZ_CP099907 | ||
| Organism | Escherichia albertii strain 112_1_EW_A | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | S1PD89 |
| Locus tag | NIY89_RS05020 | Protein ID | WP_000956458.1 |
| Coordinates | 1053943..1054095 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 1053849..1053901 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY89_RS05005 | 1049253..1051052 | + | 1800 | WP_233991385.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
| NIY89_RS05010 | 1051052..1052764 | + | 1713 | WP_059224425.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| NIY89_RS05015 | 1052944..1053678 | + | 735 | WP_059216810.1 | phosphoadenosine phosphosulfate reductase | - |
| - | 1053849..1053901 | - | 53 | - | - | Antitoxin |
| NIY89_RS05020 | 1053943..1054095 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
| NIY89_RS05025 | 1054221..1055258 | - | 1038 | WP_059225076.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
| NIY89_RS05030 | 1055511..1056419 | + | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
| NIY89_RS05035 | 1056421..1057848 | + | 1428 | WP_137648822.1 | sulfate adenylyltransferase subunit CysN | - |
| NIY89_RS05040 | 1057848..1058453 | + | 606 | WP_024164730.1 | adenylyl-sulfate kinase | - |
| NIY89_RS05045 | 1058503..1058826 | + | 324 | WP_044711292.1 | DUF3561 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T249892 WP_000956458.1 NZ_CP099907:1053943-1054095 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT249892 NZ_CP099907:c1053901-1053849 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|