Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 167434..167691 Replicon chromosome
Accession NZ_CP099907
Organism Escherichia albertii strain 112_1_EW_A

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag NIY89_RS00760 Protein ID WP_001135738.1
Coordinates 167539..167691 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 167434..167488 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY89_RS00740 162663..163658 - 996 WP_059259085.1 acyltransferase -
NIY89_RS00745 163831..164130 + 300 WP_256876080.1 YsaB family lipoprotein -
NIY89_RS00750 164226..165137 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
NIY89_RS00755 165147..167216 + 2070 WP_059221279.1 glycine--tRNA ligase subunit beta -
- 167434..167488 - 55 - - Antitoxin
NIY89_RS00760 167539..167691 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
NIY89_RS00765 167668..167739 - 72 WP_212734940.1 hypothetical protein -
NIY89_RS00770 167879..168091 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
NIY89_RS00775 168374..168664 - 291 WP_059225708.1 HTH-type transcriptional regulator -
NIY89_RS00780 169087..169797 + 711 WP_002460072.1 DUF3053 domain-containing protein -
NIY89_RS00785 169850..170824 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
NIY89_RS00790 170928..171587 - 660 WP_256876081.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T249889 WP_001135738.1 NZ_CP099907:167539-167691 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT249889 NZ_CP099907:c167488-167434 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References