Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2494838..2495637 | Replicon | chromosome |
| Accession | NZ_CP099906 | ||
| Organism | Escherichia albertii strain 121_1_EW_A | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
| Locus tag | NIY90_RS12115 | Protein ID | WP_059227548.1 |
| Coordinates | 2495173..2495637 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | NIY90_RS12110 | Protein ID | WP_001296435.1 |
| Coordinates | 2494838..2495173 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY90_RS12095 (2490627) | 2490627..2491397 | - | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NIY90_RS12100 (2491413) | 2491413..2492747 | - | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NIY90_RS12105 (2493118) | 2493118..2494689 | + | 1572 | WP_256878808.1 | galactarate dehydratase | - |
| NIY90_RS12110 (2494838) | 2494838..2495173 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NIY90_RS12115 (2495173) | 2495173..2495637 | + | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NIY90_RS12120 (2495692) | 2495692..2496501 | - | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
| NIY90_RS12125 (2496750) | 2496750..2498030 | + | 1281 | WP_256878807.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NIY90_RS12130 (2498053) | 2498053..2498526 | + | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NIY90_RS12135 (2498537) | 2498537..2499316 | + | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NIY90_RS12140 (2499306) | 2499306..2500184 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NIY90_RS12145 (2500202) | 2500202..2500636 | + | 435 | WP_149451364.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T249878 WP_059227548.1 NZ_CP099906:2495173-2495637 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|