Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2011860..2012587 | Replicon | chromosome |
Accession | NZ_CP099906 | ||
Organism | Escherichia albertii strain 121_1_EW_A |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q3YYE6 |
Locus tag | NIY90_RS09905 | Protein ID | WP_000547563.1 |
Coordinates | 2012276..2012587 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NIY90_RS09900 | Protein ID | WP_000126297.1 |
Coordinates | 2011860..2012279 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY90_RS09885 (2007979) | 2007979..2010231 | - | 2253 | WP_256878885.1 | carbamoyltransferase HypF | - |
NIY90_RS09890 (2010384) | 2010384..2010911 | - | 528 | WP_001078780.1 | electron transport protein HydN | - |
NIY90_RS09895 (2011340) | 2011340..2011768 | + | 429 | WP_000536064.1 | hypothetical protein | - |
NIY90_RS09900 (2011860) | 2011860..2012279 | - | 420 | WP_000126297.1 | helix-turn-helix domain-containing protein | Antitoxin |
NIY90_RS09905 (2012276) | 2012276..2012587 | - | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NIY90_RS09910 (2012749) | 2012749..2013504 | - | 756 | WP_125060797.1 | hypothetical protein | - |
NIY90_RS09915 (2013547) | 2013547..2014017 | - | 471 | WP_059219259.1 | hydrogenase maturation peptidase HycI | - |
NIY90_RS09920 (2014010) | 2014010..2014420 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
NIY90_RS09925 (2014417) | 2014417..2015184 | - | 768 | WP_059214453.1 | formate hydrogenlyase subunit HycG | - |
NIY90_RS09930 (2015184) | 2015184..2015726 | - | 543 | WP_000493797.1 | formate hydrogenlyase subunit HycF | - |
NIY90_RS09935 (2015736) | 2015736..2017445 | - | 1710 | WP_256921794.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T249874 WP_000547563.1 NZ_CP099906:c2012587-2012276 [Escherichia albertii]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15446.45 Da Isoelectric Point: 4.4596
>AT249874 WP_000126297.1 NZ_CP099906:c2012279-2011860 [Escherichia albertii]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|