Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3708099..3708749 | Replicon | chromosome |
| Accession | NZ_CP099903 | ||
| Organism | Escherichia albertii strain 133_1_GWG_A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIY95_RS18115 | Protein ID | WP_059224977.1 |
| Coordinates | 3708408..3708749 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | NIY95_RS18110 | Protein ID | WP_025237546.1 |
| Coordinates | 3708099..3708398 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY95_RS18080 (3703229) | 3703229..3703540 | - | 312 | WP_059224980.1 | hypothetical protein | - |
| NIY95_RS18085 (3703545) | 3703545..3703937 | - | 393 | WP_000273381.1 | flagellar export chaperone FliS | - |
| NIY95_RS18090 (3703960) | 3703960..3705276 | - | 1317 | WP_000609691.1 | flagellar filament capping protein FliD | - |
| NIY95_RS18095 (3705343) | 3705343..3705678 | - | 336 | WP_256876143.1 | hypothetical protein | - |
| NIY95_RS18100 (3705789) | 3705789..3706703 | - | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| NIY95_RS18105 (3707190) | 3707190..3708041 | + | 852 | WP_233991701.1 | winged helix-turn-helix domain-containing protein | - |
| NIY95_RS18110 (3708099) | 3708099..3708398 | - | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| NIY95_RS18115 (3708408) | 3708408..3708749 | - | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIY95_RS18120 (3708825) | 3708825..3709802 | - | 978 | Protein_3536 | flagellar hook-associated protein | - |
| NIY95_RS18125 (3709819) | 3709819..3710748 | - | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
| NIY95_RS18130 (3710763) | 3710763..3712139 | - | 1377 | WP_233991702.1 | flagellar hook-associated protein FlgK | - |
| NIY95_RS18135 (3712697) | 3712697..3712996 | - | 300 | WP_059224974.1 | rod-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T249855 WP_059224977.1 NZ_CP099903:c3708749-3708408 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|