Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2821238..2821463 Replicon chromosome
Accession NZ_CP099903
Organism Escherichia albertii strain 133_1_GWG_A

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag NIY95_RS13865 Protein ID WP_000813269.1
Coordinates 2821238..2821393 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2821405..2821463 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY95_RS13820 2816523..2817020 - 498 WP_001135262.1 lysozyme RrrD -
NIY95_RS13825 2817020..2817235 - 216 WP_000839574.1 class II holin family protein -
NIY95_RS13840 2818035..2818853 - 819 WP_256876231.1 CPBP family intramembrane metalloprotease -
NIY95_RS13845 2818996..2819364 - 369 WP_059217965.1 antiterminator Q family protein -
NIY95_RS13850 2819357..2819734 - 378 WP_059274539.1 RusA family crossover junction endodeoxyribonuclease -
NIY95_RS13855 2819735..2820790 - 1056 WP_105210958.1 DUF968 domain-containing protein -
NIY95_RS13860 2820792..2821070 - 279 WP_059274501.1 hypothetical protein -
NIY95_RS13865 2821238..2821393 - 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
- 2821405..2821463 + 59 - - Antitoxin
NIY95_RS13870 2821654..2821737 - 84 Protein_2710 ORF6N domain-containing protein -
NIY95_RS13875 2821999..2822772 + 774 WP_256876232.1 alpha/beta hydrolase -
NIY95_RS13880 2823128..2823538 - 411 WP_059274497.1 DUF977 family protein -
NIY95_RS13885 2823546..2824307 - 762 WP_059274498.1 DUF1627 domain-containing protein -
NIY95_RS13890 2824331..2825077 - 747 WP_059274499.1 ATP-binding protein -
NIY95_RS13895 2825084..2826046 - 963 WP_105210960.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - espM2 / espM2 / espW 2786714..2840308 53594
- inside Prophage - espM2 / espM2 / espW 2717657..2858489 140832


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T249852 WP_000813269.1 NZ_CP099903:c2821393-2821238 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT249852 NZ_CP099903:2821405-2821463 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References