Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 167443..167700 Replicon chromosome
Accession NZ_CP099903
Organism Escherichia albertii strain 133_1_GWG_A

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag NIY95_RS00760 Protein ID WP_001135738.1
Coordinates 167548..167700 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 167443..167497 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY95_RS00740 162672..163667 - 996 WP_059259085.1 acyltransferase -
NIY95_RS00745 163840..164139 + 300 WP_256876080.1 YsaB family lipoprotein -
NIY95_RS00750 164235..165146 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
NIY95_RS00755 165156..167225 + 2070 WP_059221279.1 glycine--tRNA ligase subunit beta -
- 167443..167497 - 55 - - Antitoxin
NIY95_RS00760 167548..167700 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
NIY95_RS00765 167677..167748 - 72 WP_212734940.1 hypothetical protein -
NIY95_RS00770 167888..168100 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
NIY95_RS00775 168383..168673 - 291 WP_059225708.1 HTH-type transcriptional regulator -
NIY95_RS00780 169096..169806 + 711 WP_002460072.1 DUF3053 domain-containing protein -
NIY95_RS00785 169859..170833 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
NIY95_RS00790 170937..171596 - 660 WP_256876081.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T249840 WP_001135738.1 NZ_CP099903:167548-167700 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT249840 NZ_CP099903:c167497-167443 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References