Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 636106..636833 | Replicon | chromosome |
Accession | NZ_CP099898 | ||
Organism | Escherichia albertii strain 147_1_TBG_A |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | NIZ13_RS03130 | Protein ID | WP_000550189.1 |
Coordinates | 636106..636420 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NIZ13_RS03135 | Protein ID | WP_000560272.1 |
Coordinates | 636417..636833 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ13_RS03110 (632265) | 632265..633251 | - | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
NIZ13_RS03115 (633330) | 633330..634022 | - | 693 | WP_059215025.1 | vancomycin high temperature exclusion protein | - |
NIZ13_RS03120 (634099) | 634099..634602 | - | 504 | WP_059215024.1 | M48 family metallopeptidase | - |
NIZ13_RS03125 (634687) | 634687..635823 | + | 1137 | WP_059241776.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NIZ13_RS03130 (636106) | 636106..636420 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
NIZ13_RS03135 (636417) | 636417..636833 | + | 417 | WP_000560272.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
NIZ13_RS03140 (636923) | 636923..638941 | - | 2019 | WP_059216457.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NIZ13_RS03145 (639166) | 639166..641517 | - | 2352 | WP_059235423.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T249819 WP_000550189.1 NZ_CP099898:636106-636420 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14993.40 Da Isoelectric Point: 4.3697
>AT249819 WP_000560272.1 NZ_CP099898:636417-636833 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|