Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 166074..166331 Replicon chromosome
Accession NZ_CP099898
Organism Escherichia albertii strain 147_1_TBG_A

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag NIZ13_RS00745 Protein ID WP_001135738.1
Coordinates 166179..166331 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 166074..166122 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ13_RS00725 161304..162299 - 996 WP_059235567.1 acyltransferase -
NIZ13_RS00730 162472..162771 + 300 WP_000979961.1 YsaB family lipoprotein -
NIZ13_RS00735 162867..163778 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
NIZ13_RS00740 163788..165857 + 2070 WP_059235569.1 glycine--tRNA ligase subunit beta -
- 166074..166122 - 49 - - Antitoxin
NIZ13_RS00745 166179..166331 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
NIZ13_RS00750 166308..166379 - 72 WP_212734940.1 hypothetical protein -
NIZ13_RS00755 166519..166731 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
NIZ13_RS00760 167014..167304 - 291 WP_000455794.1 HTH-type transcriptional regulator -
NIZ13_RS00765 167727..168437 + 711 WP_002460072.1 DUF3053 domain-containing protein -
NIZ13_RS00770 168490..169464 - 975 WP_059235571.1 glyoxylate/hydroxypyruvate reductase GhrB -
NIZ13_RS00775 169568..170227 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T249816 WP_001135738.1 NZ_CP099898:166179-166331 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT249816 NZ_CP099898:c166122-166074 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References