Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2437631..2438430 | Replicon | chromosome |
Accession | NZ_CP099890 | ||
Organism | Escherichia albertii strain 205_2_TBG_B |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
Locus tag | NIZ17_RS12200 | Protein ID | WP_059227548.1 |
Coordinates | 2437631..2438095 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | NIZ17_RS12205 | Protein ID | WP_060877482.1 |
Coordinates | 2438095..2438430 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ17_RS12170 (2432632) | 2432632..2433066 | - | 435 | WP_149451364.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NIZ17_RS12175 (2433084) | 2433084..2433962 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NIZ17_RS12180 (2433952) | 2433952..2434731 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NIZ17_RS12185 (2434742) | 2434742..2435215 | - | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NIZ17_RS12190 (2435238) | 2435238..2436518 | - | 1281 | WP_059235447.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NIZ17_RS12195 (2436767) | 2436767..2437576 | + | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
NIZ17_RS12200 (2437631) | 2437631..2438095 | - | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NIZ17_RS12205 (2438095) | 2438095..2438430 | - | 336 | WP_060877482.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NIZ17_RS12210 (2438579) | 2438579..2440150 | - | 1572 | WP_256879795.1 | galactarate dehydratase | - |
NIZ17_RS12215 (2440521) | 2440521..2441855 | + | 1335 | WP_000599659.1 | galactarate/glucarate/glycerate transporter GarP | - |
NIZ17_RS12220 (2441871) | 2441871..2442641 | + | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T249756 WP_059227548.1 NZ_CP099890:c2438095-2437631 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|