Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 2091312..2092024 | Replicon | chromosome |
| Accession | NZ_CP099890 | ||
| Organism | Escherichia albertii strain 205_2_TBG_B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | NIZ17_RS10375 | Protein ID | WP_000162413.1 |
| Coordinates | 2091722..2092024 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIZ17_RS10370 | Protein ID | WP_000806446.1 |
| Coordinates | 2091312..2091650 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ17_RS10345 (2086363) | 2086363..2088345 | + | 1983 | WP_124866558.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| NIZ17_RS10350 (2088394) | 2088394..2089422 | + | 1029 | WP_103054025.1 | hematinate-forming heme oxygenase ChuS | - |
| NIZ17_RS10355 (2089494) | 2089494..2090024 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| NIZ17_RS10360 (2090171) | 2090171..2090737 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| NIZ17_RS10365 (2091084) | 2091084..2091221 | - | 138 | WP_199768253.1 | hypothetical protein | - |
| NIZ17_RS10370 (2091312) | 2091312..2091650 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| NIZ17_RS10375 (2091722) | 2091722..2092024 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIZ17_RS10380 (2092188) | 2092188..2092667 | + | 480 | WP_256880683.1 | hypothetical protein | - |
| NIZ17_RS10385 (2092757) | 2092757..2092930 | - | 174 | WP_000553433.1 | hypothetical protein | - |
| NIZ17_RS10390 (2092958) | 2092958..2093041 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| NIZ17_RS10395 (2093095) | 2093095..2094447 | - | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
| NIZ17_RS10400 (2094519) | 2094519..2095361 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T249754 WP_000162413.1 NZ_CP099890:c2092024-2091722 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|