Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1638414..1639016 | Replicon | chromosome |
| Accession | NZ_CP099890 | ||
| Organism | Escherichia albertii strain 205_2_TBG_B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | NIZ17_RS08215 | Protein ID | WP_000897302.1 |
| Coordinates | 1638705..1639016 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIZ17_RS08210 | Protein ID | WP_000356397.1 |
| Coordinates | 1638414..1638704 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ17_RS08175 (1634268) | 1634268..1635170 | + | 903 | WP_000331387.1 | formate dehydrogenase O subunit beta | - |
| NIZ17_RS08180 (1635167) | 1635167..1635802 | + | 636 | WP_059277370.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NIZ17_RS08185 (1635799) | 1635799..1636728 | + | 930 | WP_000027704.1 | formate dehydrogenase accessory protein FdhE | - |
| NIZ17_RS08190 (1636765) | 1636765..1637139 | - | 375 | WP_256880610.1 | type II toxin-antitoxin system VapC family toxin | - |
| NIZ17_RS08195 (1637139) | 1637139..1637357 | - | 219 | WP_171002579.1 | CopG family transcriptional regulator | - |
| NIZ17_RS08200 (1637778) | 1637778..1638056 | - | 279 | WP_000102977.1 | hypothetical protein | - |
| NIZ17_RS08205 (1638108) | 1638108..1638329 | - | 222 | WP_256880611.1 | cobalt ABC transporter ATP-binding protein | - |
| NIZ17_RS08210 (1638414) | 1638414..1638704 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NIZ17_RS08215 (1638705) | 1638705..1639016 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| NIZ17_RS08220 (1639245) | 1639245..1640153 | + | 909 | WP_256880612.1 | alpha/beta hydrolase | - |
| NIZ17_RS08225 (1640217) | 1640217..1641158 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NIZ17_RS08230 (1641203) | 1641203..1641640 | - | 438 | WP_000560977.1 | D-aminoacyl-tRNA deacylase | - |
| NIZ17_RS08235 (1641637) | 1641637..1642509 | - | 873 | WP_256880613.1 | virulence factor BrkB family protein | - |
| NIZ17_RS08240 (1642503) | 1642503..1643102 | - | 600 | WP_002460585.1 | glucose-1-phosphatase | - |
| NIZ17_RS08245 (1643201) | 1643201..1643986 | - | 786 | WP_000059671.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T249752 WP_000897302.1 NZ_CP099890:c1639016-1638705 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|