Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 730344..730994 | Replicon | chromosome |
| Accession | NZ_CP099890 | ||
| Organism | Escherichia albertii strain 205_2_TBG_B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIZ17_RS03825 | Protein ID | WP_059224977.1 |
| Coordinates | 730653..730994 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | NIZ17_RS03820 | Protein ID | WP_025237546.1 |
| Coordinates | 730344..730643 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ17_RS03795 (725681) | 725681..725992 | - | 312 | WP_000410252.1 | hypothetical protein | - |
| NIZ17_RS03800 (725997) | 725997..726386 | - | 390 | WP_256880433.1 | flagellar export chaperone FliS | - |
| NIZ17_RS03805 (726409) | 726409..727725 | - | 1317 | WP_000609691.1 | flagellar filament capping protein FliD | - |
| NIZ17_RS03810 (728034) | 728034..728948 | - | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| NIZ17_RS03815 (729435) | 729435..730286 | + | 852 | WP_000022899.1 | winged helix-turn-helix domain-containing protein | - |
| NIZ17_RS03820 (730344) | 730344..730643 | - | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| NIZ17_RS03825 (730653) | 730653..730994 | - | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIZ17_RS03830 (731070) | 731070..732047 | - | 978 | Protein_743 | flagellar hook-associated protein | - |
| NIZ17_RS03835 (732064) | 732064..732993 | - | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
| NIZ17_RS03840 (733008) | 733008..734384 | - | 1377 | WP_025237549.1 | flagellar hook-associated protein FlgK | - |
| NIZ17_RS03845 (735060) | 735060..735359 | - | 300 | WP_059254376.1 | rod-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T249748 WP_059224977.1 NZ_CP099890:c730994-730653 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|