Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 635397..636124 | Replicon | chromosome |
Accession | NZ_CP099887 | ||
Organism | Escherichia albertii strain 208_2_GWG_B |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | NIZ18_RS03130 | Protein ID | WP_000550189.1 |
Coordinates | 635397..635711 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NIZ18_RS03135 | Protein ID | WP_000560272.1 |
Coordinates | 635708..636124 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ18_RS03110 (631556) | 631556..632542 | - | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
NIZ18_RS03115 (632621) | 632621..633313 | - | 693 | WP_059215025.1 | vancomycin high temperature exclusion protein | - |
NIZ18_RS03120 (633390) | 633390..633893 | - | 504 | WP_059215024.1 | M48 family metallopeptidase | - |
NIZ18_RS03125 (633978) | 633978..635114 | + | 1137 | WP_059241776.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NIZ18_RS03130 (635397) | 635397..635711 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
NIZ18_RS03135 (635708) | 635708..636124 | + | 417 | WP_000560272.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
NIZ18_RS03140 (636214) | 636214..638232 | - | 2019 | WP_059216457.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NIZ18_RS03145 (638457) | 638457..640808 | - | 2352 | WP_059235423.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T249726 WP_000550189.1 NZ_CP099887:635397-635711 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14993.40 Da Isoelectric Point: 4.3697
>AT249726 WP_000560272.1 NZ_CP099887:635708-636124 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|