Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 593715..594514 | Replicon | chromosome |
| Accession | NZ_CP099887 | ||
| Organism | Escherichia albertii strain 208_2_GWG_B | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | NIZ18_RS02925 | Protein ID | WP_059235443.1 |
| Coordinates | 593715..594179 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | NIZ18_RS02930 | Protein ID | WP_001296435.1 |
| Coordinates | 594179..594514 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ18_RS02895 (588716) | 588716..589150 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NIZ18_RS02900 (589168) | 589168..590046 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NIZ18_RS02905 (590036) | 590036..590815 | - | 780 | WP_105175636.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NIZ18_RS02910 (590826) | 590826..591299 | - | 474 | WP_059218168.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NIZ18_RS02915 (591322) | 591322..592602 | - | 1281 | WP_059235447.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NIZ18_RS02920 (592851) | 592851..593660 | + | 810 | WP_059235445.1 | aga operon transcriptional regulator AgaR | - |
| NIZ18_RS02925 (593715) | 593715..594179 | - | 465 | WP_059235443.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NIZ18_RS02930 (594179) | 594179..594514 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NIZ18_RS02935 (594663) | 594663..596234 | - | 1572 | WP_059235441.1 | galactarate dehydratase | - |
| NIZ18_RS02940 (596605) | 596605..597939 | + | 1335 | WP_059241781.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NIZ18_RS02945 (597955) | 597955..598725 | + | 771 | WP_059235438.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17825.22 Da Isoelectric Point: 9.6804
>T249725 WP_059235443.1 NZ_CP099887:c594179-593715 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSSAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSSAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|