Detailed information of TA system TA249713

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 4547103..4547328
• Replicon: chromosome
• Accession: NZ_CP099886
• Organism: Escherichia albertii strain 222_1_EW_B

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: NIZ19_RS22310
• Protein ID: WP_000813263.1
• Coordinates: 4547103..4547258 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	4547270..4547328 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIZ19_RS22250	4542204..4542548	-	345	WP_064560427.1	YdfR family protein	-
NIZ19_RS22255	4542553..4542768	-	216	WP_000839567.1	class II holin family protein	-
NIZ19_RS22280	4543400..4544113	-	714	WP_256877236.1	helix-turn-helix domain-containing protein	-
NIZ19_RS22285	4544248..4544445	-	198	WP_000917763.1	hypothetical protein	-
NIZ19_RS22290	4544668..4545222	-	555	WP_249987867.1	DUF1133 family protein	-
NIZ19_RS22295	4545231..4545596	-	366	WP_256877237.1	RusA family crossover junction endodeoxyribonuclease	-
NIZ19_RS22300	4545597..4546655	-	1059	WP_089521776.1	DUF968 domain-containing protein	-
NIZ19_RS22305	4546657..4546935	-	279	WP_001341388.1	hypothetical protein	-
NIZ19_RS22310	4547103..4547258	-	156	WP_000813263.1	type I toxin-antitoxin system toxin HokD	Toxin
-	4547270..4547328	+	59	-	-	Antitoxin
NIZ19_RS22315	4547504..4547608	-	105	WP_001278454.1	hypothetical protein	-
NIZ19_RS22320	4547724..4547912	-	189	WP_064769369.1	DUF551 domain-containing protein	-
NIZ19_RS22325	4548162..4548257	-	96	Protein_4336	hypothetical protein	-
NIZ19_RS22330	4548468..4548593	-	126	Protein_4337	hypothetical protein	-
NIZ19_RS22335	4548604..4548867	-	264	WP_000224233.1	hypothetical protein	-
NIZ19_RS22340	4548869..4549087	-	219	WP_000209148.1	DUF4014 family protein	-
NIZ19_RS22345	4549120..4549332	-	213	WP_000935424.1	hypothetical protein	-
NIZ19_RS22350	4549438..4549860	-	423	WP_001151239.1	DUF977 family protein	-
NIZ19_RS22355	4549876..4550646	-	771	WP_000450998.1	DUF1627 domain-containing protein	-
NIZ19_RS22360	4550668..4551414	-	747	WP_000788950.1	ATP-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	4519782..4564182	44400
	-	inside	Prophage	-	ompA	4519782..4588530	68748

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5722.86 Da
• Isoelectric Point: 6.1531

>T249713 WP_000813263.1 NZ_CP099886:c4547258-4547103 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT249713 NZ_CP099886:4547270-4547328 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTTTGTGAAGCATAGATTGGGCCTCA

Structures

Antitoxin