Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 2066891..2067493 Replicon chromosome
Accession NZ_CP099886
Organism Escherichia albertii strain 222_1_EW_B

Toxin (Protein)


Gene name higB Uniprot ID S1P416
Locus tag NIZ19_RS10105 Protein ID WP_000897302.1
Coordinates 2066891..2067202 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NIZ19_RS10110 Protein ID WP_000356397.1
Coordinates 2067203..2067493 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ19_RS10075 (2061921) 2061921..2062706 + 786 WP_000059671.1 DeoR/GlpR family DNA-binding transcription regulator -
NIZ19_RS10080 (2062805) 2062805..2063404 + 600 WP_002460585.1 glucose-1-phosphatase -
NIZ19_RS10085 (2063398) 2063398..2064270 + 873 WP_000916663.1 virulence factor BrkB family protein -
NIZ19_RS10090 (2064267) 2064267..2064704 + 438 WP_000560977.1 D-aminoacyl-tRNA deacylase -
NIZ19_RS10095 (2064749) 2064749..2065690 + 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
NIZ19_RS10100 (2065754) 2065754..2066662 - 909 WP_059239594.1 alpha/beta hydrolase -
NIZ19_RS10105 (2066891) 2066891..2067202 + 312 WP_000897302.1 hypothetical protein Toxin
NIZ19_RS10110 (2067203) 2067203..2067493 + 291 WP_000356397.1 NadS family protein Antitoxin
NIZ19_RS10115 (2067578) 2067578..2067790 + 213 WP_000197774.1 hypothetical protein -
NIZ19_RS10120 (2067852) 2067852..2068130 + 279 WP_032278934.1 hypothetical protein -
NIZ19_RS10125 (2068529) 2068529..2068747 + 219 WP_001314326.1 CopG family transcriptional regulator -
NIZ19_RS10130 (2068975) 2068975..2069217 + 243 WP_103054107.1 CopG family transcriptional regulator -
NIZ19_RS10135 (2069217) 2069217..2069591 + 375 WP_107192776.1 type II toxin-antitoxin system VapC family toxin -
NIZ19_RS10140 (2069628) 2069628..2070557 - 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
NIZ19_RS10145 (2070554) 2070554..2071189 - 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
NIZ19_RS10150 (2071186) 2071186..2072088 - 903 WP_000331386.1 formate dehydrogenase O subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12203.19 Da        Isoelectric Point: 9.7791

>T249695 WP_000897302.1 NZ_CP099886:2066891-2067202 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10846.43 Da        Isoelectric Point: 10.8907

>AT249695 WP_000356397.1 NZ_CP099886:2067203-2067493 [Escherichia albertii]
MDKALFERLTHSMAQMNEIIEGTRQPSRTFEVDAMKIKEIRRASGLSQSKFADLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVLQALNR

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1P416

Antitoxin

Source ID Structure

References