Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1496326..1497125 | Replicon | chromosome |
Accession | NZ_CP099886 | ||
Organism | Escherichia albertii strain 222_1_EW_B |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
Locus tag | NIZ19_RS07450 | Protein ID | WP_059227548.1 |
Coordinates | 1496326..1496790 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | NIZ19_RS07455 | Protein ID | WP_001296435.1 |
Coordinates | 1496790..1497125 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ19_RS07420 (1491327) | 1491327..1491761 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NIZ19_RS07425 (1491779) | 1491779..1492657 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NIZ19_RS07430 (1492647) | 1492647..1493426 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NIZ19_RS07435 (1493437) | 1493437..1493910 | - | 474 | WP_256877556.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NIZ19_RS07440 (1493933) | 1493933..1495213 | - | 1281 | WP_059227551.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NIZ19_RS07445 (1495462) | 1495462..1496271 | + | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
NIZ19_RS07450 (1496326) | 1496326..1496790 | - | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NIZ19_RS07455 (1496790) | 1496790..1497125 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NIZ19_RS07460 (1497274) | 1497274..1498845 | - | 1572 | WP_059256163.1 | galactarate dehydratase | - |
NIZ19_RS07465 (1499215) | 1499215..1500549 | + | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
NIZ19_RS07470 (1500565) | 1500565..1501335 | + | 771 | WP_001058056.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T249693 WP_059227548.1 NZ_CP099886:c1496790-1496326 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|