Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 23449..23718 | Replicon | plasmid plas2 |
| Accession | NZ_CP099885 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NIZ20_RS24275 | Protein ID | WP_001372321.1 |
| Coordinates | 23593..23718 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 23449..23514 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS24230 | 18518..18745 | + | 228 | WP_071594011.1 | hypothetical protein | - |
| NIZ20_RS24235 | 18986..19192 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| NIZ20_RS24240 | 19218..19757 | + | 540 | WP_000290812.1 | single-stranded DNA-binding protein | - |
| NIZ20_RS24245 | 19819..20052 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| NIZ20_RS24250 | 20117..22075 | + | 1959 | WP_000117210.1 | ParB/RepB/Spo0J family partition protein | - |
| NIZ20_RS24255 | 22130..22564 | + | 435 | WP_000845873.1 | conjugation system SOS inhibitor PsiB | - |
| NIZ20_RS24260 | 22561..23323 | + | 763 | Protein_31 | plasmid SOS inhibition protein A | - |
| NIZ20_RS24265 | 23292..23480 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 23292..23516 | + | 225 | NuclAT_0 | - | - |
| - | 23292..23516 | + | 225 | NuclAT_0 | - | - |
| - | 23292..23516 | + | 225 | NuclAT_0 | - | - |
| - | 23292..23516 | + | 225 | NuclAT_0 | - | - |
| - | 23449..23514 | - | 66 | - | - | Antitoxin |
| NIZ20_RS24270 | 23502..23651 | + | 150 | Protein_33 | plasmid maintenance protein Mok | - |
| NIZ20_RS24275 | 23593..23718 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NIZ20_RS24280 | 23938..24168 | + | 231 | WP_256876178.1 | hypothetical protein | - |
| NIZ20_RS24285 | 24166..24339 | - | 174 | Protein_36 | hypothetical protein | - |
| NIZ20_RS24290 | 24409..24615 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| NIZ20_RS24295 | 24640..24927 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| NIZ20_RS24300 | 25047..25868 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| NIZ20_RS24305 | 26165..26812 | - | 648 | WP_256876177.1 | transglycosylase SLT domain-containing protein | - |
| NIZ20_RS24310 | 27089..27472 | + | 384 | WP_000124979.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NIZ20_RS24315 | 27663..28349 | + | 687 | WP_000332493.1 | PAS domain-containing protein | - |
| NIZ20_RS24320 | 28443..28670 | + | 228 | WP_001254385.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 | 1..89097 | 89097 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T249689 WP_001372321.1 NZ_CP099885:23593-23718 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT249689 NZ_CP099885:c23514-23449 [Escherichia albertii]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|