Detailed information of TA system TA249688

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 23292..23718
• Replicon: plasmid plas2
• Accession: NZ_CP099885
• Organism: Escherichia albertii strain 231_1_NP_B

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NIZ20_RS24275
• Protein ID: WP_001372321.1
• Coordinates: 23593..23718 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	23292..23516 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NIZ20_RS24230 (18518)	18518..18745	+	228	WP_071594011.1	hypothetical protein	-
NIZ20_RS24235 (18986)	18986..19192	+	207	WP_000547971.1	hypothetical protein	-
NIZ20_RS24240 (19218)	19218..19757	+	540	WP_000290812.1	single-stranded DNA-binding protein	-
NIZ20_RS24245 (19819)	19819..20052	+	234	WP_000006030.1	DUF905 family protein	-
NIZ20_RS24250 (20117)	20117..22075	+	1959	WP_000117210.1	ParB/RepB/Spo0J family partition protein	-
NIZ20_RS24255 (22130)	22130..22564	+	435	WP_000845873.1	conjugation system SOS inhibitor PsiB	-
NIZ20_RS24260 (22561)	22561..23323	+	763	Protein_31	plasmid SOS inhibition protein A	-
NIZ20_RS24265 (23292)	23292..23480	-	189	WP_001299721.1	hypothetical protein	-
- (23292)	23292..23516	+	225	NuclAT_0	-	Antitoxin
- (23292)	23292..23516	+	225	NuclAT_0	-	Antitoxin
- (23292)	23292..23516	+	225	NuclAT_0	-	Antitoxin
- (23292)	23292..23516	+	225	NuclAT_0	-	Antitoxin
NIZ20_RS24270 (23502)	23502..23651	+	150	Protein_33	plasmid maintenance protein Mok	-
NIZ20_RS24275 (23593)	23593..23718	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NIZ20_RS24280 (23938)	23938..24168	+	231	WP_256876178.1	hypothetical protein	-
NIZ20_RS24285 (24166)	24166..24339	-	174	Protein_36	hypothetical protein	-
NIZ20_RS24290 (24409)	24409..24615	+	207	WP_000547971.1	hypothetical protein	-
NIZ20_RS24295 (24640)	24640..24927	+	288	WP_000107535.1	hypothetical protein	-
NIZ20_RS24300 (25047)	25047..25868	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NIZ20_RS24305 (26165)	26165..26812	-	648	WP_256876177.1	transglycosylase SLT domain-containing protein	-
NIZ20_RS24310 (27089)	27089..27472	+	384	WP_000124979.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NIZ20_RS24315 (27663)	27663..28349	+	687	WP_000332493.1	PAS domain-containing protein	-
NIZ20_RS24320 (28443)	28443..28670	+	228	WP_001254385.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	espL2	1..89097	89097

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T249688 WP_001372321.1 NZ_CP099885:23593-23718 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT249688 NZ_CP099885:23292-23516 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin