Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4167891..4168148 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | NIZ20_RS20315 | Protein ID | WP_001135738.1 |
| Coordinates | 4167891..4168043 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4168094..4168148 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS20285 | 4163995..4164654 | + | 660 | WP_256876081.1 | OmpA family lipoprotein | - |
| NIZ20_RS20290 | 4164758..4165732 | + | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| NIZ20_RS20295 | 4165785..4166495 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| NIZ20_RS20300 | 4166918..4167208 | + | 291 | WP_059225708.1 | HTH-type transcriptional regulator | - |
| NIZ20_RS20305 | 4167491..4167703 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| NIZ20_RS20310 | 4167843..4167914 | + | 72 | WP_212734940.1 | hypothetical protein | - |
| NIZ20_RS20315 | 4167891..4168043 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 4168094..4168148 | + | 55 | - | - | Antitoxin |
| NIZ20_RS20320 | 4168366..4170435 | - | 2070 | WP_059221279.1 | glycine--tRNA ligase subunit beta | - |
| NIZ20_RS20325 | 4170445..4171356 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| NIZ20_RS20330 | 4171452..4171751 | - | 300 | WP_256876080.1 | YsaB family lipoprotein | - |
| NIZ20_RS20335 | 4171924..4172919 | + | 996 | WP_059259085.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T249685 WP_001135738.1 NZ_CP099883:c4168043-4167891 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT249685 NZ_CP099883:4168094-4168148 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|