Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1858573..1859135 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | L4J948 |
| Locus tag | NIZ20_RS08930 | Protein ID | WP_000605676.1 |
| Coordinates | 1858857..1859135 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NIZ20_RS08925 | Protein ID | WP_000781369.1 |
| Coordinates | 1858573..1858857 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS08910 (1856489) | 1856489..1857373 | + | 885 | WP_001240583.1 | formate dehydrogenase N subunit beta | - |
| NIZ20_RS08915 (1857366) | 1857366..1858019 | + | 654 | WP_256876185.1 | formate dehydrogenase-N subunit gamma | - |
| NIZ20_RS08920 (1858092) | 1858092..1858568 | + | 477 | WP_059225294.1 | NUDIX domain-containing protein | - |
| NIZ20_RS08925 (1858573) | 1858573..1858857 | - | 285 | WP_000781369.1 | HigA family addiction module antitoxin | Antitoxin |
| NIZ20_RS08930 (1858857) | 1858857..1859135 | - | 279 | WP_000605676.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIZ20_RS08935 (1859321) | 1859321..1860331 | - | 1011 | WP_059225293.1 | alcohol dehydrogenase AdhP | - |
| NIZ20_RS08940 (1860465) | 1860465..1862162 | - | 1698 | WP_059225292.1 | malate dehydrogenase | - |
| NIZ20_RS08945 (1862319) | 1862319..1862456 | - | 138 | WP_000841563.1 | stationary-phase-induced ribosome-associated protein | - |
| NIZ20_RS08950 (1862714) | 1862714..1863145 | + | 432 | WP_059225291.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10521.10 Da Isoelectric Point: 7.3562
>T249674 WP_000605676.1 NZ_CP099883:c1859135-1858857 [Escherichia albertii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|