Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1513861..1514086 Replicon chromosome
Accession NZ_CP099883
Organism Escherichia albertii strain 231_1_NP_B

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag NIZ20_RS07205 Protein ID WP_000813269.1
Coordinates 1513931..1514086 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1513861..1513919 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIZ20_RS07175 1509277..1510239 + 963 WP_105210960.1 helix-turn-helix domain-containing protein -
NIZ20_RS07180 1510246..1510992 + 747 WP_059274499.1 ATP-binding protein -
NIZ20_RS07185 1511016..1511778 + 763 Protein_1397 DUF1627 domain-containing protein -
NIZ20_RS07190 1511786..1512196 + 411 WP_059274497.1 DUF977 family protein -
NIZ20_RS07195 1512552..1513325 - 774 WP_256876232.1 alpha/beta hydrolase -
NIZ20_RS07200 1513587..1513670 + 84 Protein_1400 ORF6N domain-containing protein -
- 1513861..1513919 - 59 - - Antitoxin
NIZ20_RS07205 1513931..1514086 + 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
NIZ20_RS07210 1514254..1514532 + 279 WP_059274501.1 hypothetical protein -
NIZ20_RS07215 1514534..1515589 + 1056 WP_105210958.1 DUF968 domain-containing protein -
NIZ20_RS07220 1515590..1515967 + 378 WP_059274539.1 RusA family crossover junction endodeoxyribonuclease -
NIZ20_RS07225 1515960..1516328 + 369 WP_059217965.1 antiterminator Q family protein -
NIZ20_RS07230 1516471..1517289 + 819 WP_256876231.1 CPBP family intramembrane metalloprotease -
NIZ20_RS07245 1518089..1518304 + 216 WP_000839574.1 class II holin family protein -
NIZ20_RS07250 1518304..1518801 + 498 WP_001135262.1 lysozyme RrrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - espW / espM2 / espM2 1495015..1548610 53595


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T249672 WP_000813269.1 NZ_CP099883:1513931-1514086 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT249672 NZ_CP099883:c1513919-1513861 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References