Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 626578..627228 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NIZ20_RS02955 | Protein ID | WP_059224977.1 |
| Coordinates | 626578..626919 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | NIZ20_RS02960 | Protein ID | WP_025237546.1 |
| Coordinates | 626929..627228 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS02935 (622331) | 622331..622630 | + | 300 | WP_059224974.1 | rod-binding protein | - |
| NIZ20_RS02940 (623188) | 623188..624564 | + | 1377 | WP_233991702.1 | flagellar hook-associated protein FlgK | - |
| NIZ20_RS02945 (624579) | 624579..625508 | + | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
| NIZ20_RS02950 (625525) | 625525..626502 | + | 978 | Protein_574 | flagellar hook-associated protein | - |
| NIZ20_RS02955 (626578) | 626578..626919 | + | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIZ20_RS02960 (626929) | 626929..627228 | + | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| NIZ20_RS02965 (627286) | 627286..628137 | - | 852 | WP_233991701.1 | winged helix-turn-helix domain-containing protein | - |
| NIZ20_RS02970 (628624) | 628624..629538 | + | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| NIZ20_RS02975 (629649) | 629649..629984 | + | 336 | WP_256876143.1 | hypothetical protein | - |
| NIZ20_RS02980 (630051) | 630051..631367 | + | 1317 | WP_000609691.1 | flagellar filament capping protein FliD | - |
| NIZ20_RS02985 (631390) | 631390..631782 | + | 393 | WP_000273381.1 | flagellar export chaperone FliS | - |
| NIZ20_RS02990 (631787) | 631787..632098 | + | 312 | WP_059224980.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T249670 WP_059224977.1 NZ_CP099883:626578-626919 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|