Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 325451..325709 | Replicon | chromosome |
| Accession | NZ_CP099883 | ||
| Organism | Escherichia albertii strain 231_1_NP_B | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NIZ20_RS01545 | Protein ID | WP_000809168.1 |
| Coordinates | 325451..325603 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 325652..325709 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIZ20_RS01525 | 320689..321402 | - | 714 | WP_059224803.1 | acidic protein MsyB | - |
| NIZ20_RS01530 | 321429..321833 | - | 405 | WP_000833521.1 | DUF2541 family protein | - |
| NIZ20_RS01535 | 322208..324124 | + | 1917 | WP_000516137.1 | molecular chaperone DnaK | - |
| NIZ20_RS01540 | 324213..325343 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| NIZ20_RS01545 | 325451..325603 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 325652..325709 | + | 58 | - | - | Antitoxin |
| NIZ20_RS01550 | 326226..326987 | + | 762 | WP_001276206.1 | outer membrane protein OmpK | - |
| NIZ20_RS01555 | 327008..328501 | + | 1494 | WP_059214855.1 | sulfatase-like hydrolase/transferase | - |
| NIZ20_RS01560 | 328655..329902 | + | 1248 | WP_059224806.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T249669 WP_000809168.1 NZ_CP099883:c325603-325451 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT249669 NZ_CP099883:325652-325709 [Escherichia albertii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|