Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 248321..248733 | Replicon | chromosome |
Accession | NZ_CP099883 | ||
Organism | Escherichia albertii strain 231_1_NP_B |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | NIZ20_RS01175 | Protein ID | WP_059225014.1 |
Coordinates | 248321..248662 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 248657..248733 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIZ20_RS01155 (244695) | 244695..245627 | + | 933 | WP_059225013.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NIZ20_RS01160 (245780) | 245780..245953 | - | 174 | Protein_226 | GntR family transcriptional regulator | - |
NIZ20_RS01165 (246178) | 246178..247054 | + | 877 | Protein_227 | DUF262 domain-containing protein | - |
NIZ20_RS01170 (247108) | 247108..248274 | + | 1167 | WP_077696034.1 | DUF1524 domain-containing protein | - |
NIZ20_RS01175 (248321) | 248321..248662 | - | 342 | WP_059225014.1 | endoribonuclease SymE | Toxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_7 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_7 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_7 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_7 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_8 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_8 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_8 | - | Antitoxin |
- (248657) | 248657..248733 | + | 77 | NuclAT_8 | - | Antitoxin |
NIZ20_RS01180 (248891) | 248891..250186 | - | 1296 | WP_059225015.1 | restriction endonuclease subunit S | - |
NIZ20_RS01185 (250183) | 250183..251772 | - | 1590 | WP_059225016.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12384.20 Da Isoelectric Point: 7.8219
>T249666 WP_059225014.1 NZ_CP099883:c248662-248321 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT249666 NZ_CP099883:248657-248733 [Escherichia albertii]
AGTCATGATTACTATTCTCCAGAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCCAGAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|